PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00067.1.g01660.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 341aa    MW: 37069.2 Da    PI: 8.6686
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00067.1.g01660.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.41.4e-2492136145
                             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                     d+ep+rCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Zjn_sc00067.1.g01660.1.sm.mkhc  92 DPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVES 136
                                     79****************************************986 PP

2QLQ61.91.7e-212256236
                             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                                     FTaaQ+++L++Q+l+yKyL+a++PvPp+Ll++++
  Zjn_sc00067.1.g01660.1.sm.mkhc 22 VFTAAQWAELEQQALIYKYLMAGVPVPPDLLLPVR 56
                                    5********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.5E-112157IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.072257IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.0E-162356IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.34692136IPR014977WRC domain
PfamPF088793.9E-2193135IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MPSSASSAVM GMGGYPPRSA AVFTAAQWAE LEQQALIYKY LMAGVPVPPD LLLPVRPNSA  60
AFSFGPAAAA SSFYHHHHPS LSYYAYYGKK LDPEPWRCRR TDGKKWRCSK EAHPDSKYCE  120
RHMHRGRNRS RKPVESKSAS PAHQPQPQLS TVTTTTRETA PLQPLTVGIK AQSLSLGGTG  180
SSQLHVDASS YGSKFTLGGK ADDVGELSFL SGASGNNRGF TIDSPSDSSW HSLPSNVPPY  240
TLPKTRDSGL LSGAYNYSNI EPSQELGQVT IASLTQEQER HSFNGGAGGL MGNARHENQL  300
LRPFFDECPA ARDSWSEMDD ARSNRTSFST TQLSISIPRC D
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641605.10.0PREDICTED: growth-regulating factor 5 isoform X4
SwissprotQ6AWY40.0GRF5_ORYSJ; Growth-regulating factor 5
TrEMBLA0A0A9F0Q10.0A0A0A9F0Q1_ARUDO; Uncharacterized protein
STRINGBGIOSGA022056-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110462431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-22growth-regulating factor 2